Showing posts with label RNA. Show all posts
Showing posts with label RNA. Show all posts

Tuesday, 26 August 2008

You Are What You Code

If you take a cotton swab and scrape it along the inside of your cheek, you can dab the soggy end onto a glass slide, put a drop of blue stain on it and, under a microscope, see the very building blocks of what you are. The average person is pretty unlikely to get hold of a microscope. So in some ways, you’ll have to take what I write here on the basis of some kind of authority, safe in the knowledge that you can test it yourself, at least in principle. Let’s imagine you’ve done it so. What you’ll see down that eyepiece will look something like the picture I’ve provided, a strange blob with a distinctive dark dot somewhere inside it.

This is one of your cheek cells. Cells are the units that make up our bodies. Each of us is composed of about 100 trillion of these units. That’s means that there are about 10,000 times more cells in your body than there are people in the world. Break down those cells into their component parts and you get the same stuff that everything around us is made of. Loads of water firstly. Then carbon, which we see in diamonds and in the black stuff in pencils. There’s also loads of oxygen, hydrogen, nitrogen and even metals such as iron. These are quite literally the very same substances which make up the atmosphere, landscape and the everyday objects we see around us. The iron in your frying pan is no different to the iron in your blood. One is a solid lump; the other is in tiny microscopic pieces.

The DNA Blueprint

Cells are themselves very complicated structures, though we can’t see much detail through our microscope. They come together to form the structures of our body. Our muscles formed from muscle cells, our skin from skin cells, even our bones are formed from cells which eventually become solidified. It’s hard for many people to imagine how all of this non-living stuff can come together to form a person. The secret to all of this lies in that dark dot inside the cell. We’re going to need a bigger microscope.


That blob is called the nucleus. We can imagine it as being the brain of the cell, though of course it is not aware of itself in any way. If we tease the nucleus open and look inside, we get lots of protein and water. And we get 46 strange little bundles of carbon, nitrogen, hydrogen and oxygen. These are our chromosomes, within which the carbon and its friends are combined to make that most fabled of compounds; DNA. That stands for deoxyribonucleic acid. I’m not even 100% sure what that means incidentally, but trust me we’ll get by.


If we could somehow take a hold of one of those chromosomes and tug it apart, we’d find that this DNA isn’t a blob at all, but a single long string wound around itself and bundled up countless times. And if we look closer still, we find that the strand is composed of repeating patterns. Each unit of that pattern is called a nucleotide. There are four different nucleotides and each is given a letter to represent it. a, c, t and g. When we read off a given bit of our DNA, we can write it down something like this:

acactcgcttctggaacgtctgaggttatcaataagctcctagtccagacgccatgggt

Imagine that going on for roughly another three billion letters, that’s how long human DNA is, if you count all 46 chromosomes. Looking at that all day will really make your eyes sore. I have great admiration for those patient, or perhaps mildly crazy geneticists.

What does this pattern of letters actually mean? It’s a blueprint for you. The pattern is identical inside the nucleus of every cell in your body. After all, your cells were all copied from that one first cell created when you were conceived. Whether it’s in a muscle cell or a cheek cell, all that changes is which bits of the blueprint the cell reads. The way it reads them is really quite ingenious too.


The Code


Our DNA directs the way we are built. If we take cells from just one part of our body, we’ll find that they have exactly the same DNA code as every other cell, down to the last letter. But unlike the others, the cells usually use or “express” a part of that code which the others ignore. Some parts of the code are used by every cell we have, but many are unique to some part of us. When a piece of DNA is expressed, the cell makes a copy of that piece out of a similar substance called RNA. RNA too is a strand composed of four letters, but is only a copy of the specific part of the DNA that this cell is interested in. Once it is made, the RNA “message” travels right out of the nucleus of the cell and is captured by tiny structures floating around outside. The RNA message is spooled through these structures which read the message and spool out a protein. Proteins, just like DNA, are long strands. However, proteins are made up of an entirely different set of letters to our DNA. There are 20 protein letters, and although they look a lot like DNA letters, they’re quite distinct. A protein sequence looks a bit like this when we write it out:

MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGN

It looks meaningless, but it is a translation of the message sent by our DNA. The message is read in groups of three letters. Every three RNA letters corresponds to one of the 20 protein letters. So for example, the message “aag” gives us a K. “agc” gives us an S. It’s a code.


As the new protein created, it starts to wind up, tangle, knot and generally form a blob, but with a shape that is the same every time that same protein is made. This is because, as well as sticking together end-to-end in a line, some of the protein letters also like to stick together sideways. What happens next depends on what protein has just been built. Keratin, for example is one of the proteins unique to our hair follicle cells and our nails. To make hair, the keratin protein is moved to the outside of the cell where it begins to harden. DNA is transcribed to RNA messages. RNA messages are translated into proteins. And proteins can do almost anything. Some, like keratin, are exported from the cell where they may serve to build structures or alternatively to send signals to other cells. Others, called enzymes, make new substances themselves such as fats and sugars. Still others stick around inside the cell to help the cell function, perhaps building new parts for the cell or deciding which pieces of the DNA code the cell will express and when. Some proteins will even add metals to themselves. Iron, for example, makes up a part of the haemoglobin protein in blood, capturing oxygen to bring it all around our body.

Any part of our DNA which codes for a protein is called a gene. Some are expressed constantly, others in response to information and, as I said before, many will only express when the cell is in the correct part of our body. So muscle cells make strong muscle fibres, our eye cells make amazing proteins that can detect light and our immune cells make lethal poisons to kill invaders. We each have over 40,000 genes, but because of the ways that the genes can interact with each other through the actions of proteins, the actual number of proteins those 40,000 genes can make is much, much greater. Since many of those proteins can combine together or make new substances, it’s easy to see where our complexity comes from. And all of this comes from that one identical blueprint, at the core of every cell, expressed in different ways. Of course what you are is also modified by your environment. Diet, exercise and countless other influences change your body. Memories reshape your brain. That’s really a whole other story. But it all starts with the code. It’s pretty astounding what each of us can do with just four letters.